Premium ACTH 1-39 Research Peptide for Sale | 5mg Lyophilized Powder | ≥99% Purity | 48-Hour Delivery Across EU & UK
ACTH 1-39 5mg – Premium Grade
ACTH 1-39, offered at 5mg, is a premium-quality specialised research chemical developed for advanced scientific exploration in endocrine studies. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: ACTH 1-39 5mg
- Catalogue Number: ACT5-024
- Molecular Formula: C207H308N56O58S1
- Molecular Weight: 4541.07 g/mol
- Purity: 99%
- Sequence: H-DL-Ser-DL-Tyr-DL-Ser-DL-Met-DL-Glu-DL-His-DL-Phe-DL-Arg-DL-Trp-Gly-DL-Lys-DL-Pro-DL-Val-Gly-DL-Lys-DL-Lys-DL-Arg-DL-Arg-DL-Pro-DL-Val-DL-Lys-DL-Val-DL-Tyr-DL-Pro-DL-Asn-Gly-DL-Ala-DL-Glu-DL-Asp-DL-Glu-DL-Ser-DL-Ala-DL-Glu-DL-Ala-DL-Phe-DL-Pro-DL-Leu-DL-Glu-DL-Phe-OH
- Form: Lyophilised Solid
Storage and Handling:
ACTH 1-39 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.
Synthesis and Quality Assurance:
ACTH 1-39 is meticulously synthesised through a controlled process that guarantees high purity and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides ACTH 1-39 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including ACTH 1-39, are not designed for human consumption or clinical application.
Enhance your research capabilities with ACTH 1-39 in the UK. Explore our range of peptides designed for scientific rigour and innovation.
For researchers seeking to buy peptide online for investigations into melanocortin receptor signaling, melanogenesis pathways, or sexual function mechanisms, peptology.store offers this premium research compound with comprehensive documentation, including Certificates of Analysis and batch-specific purity data. Whether your laboratory is based in London, Berlin, Paris, or anywhere in the European Union, our guaranteed 48 hour delivery peptide service ensures your research continues without interruption.
The Scientific Foundation of ACTH 1-39 Research
Discovery and Development
ACTH 1-39 (Adrenocorticotropic Hormone) is a naturally occurring peptide hormone produced by the pituitary gland from the precursor proopiomelanocortin (POMC). It plays a central role in regulating the hypothalamic-pituitary-adrenal (HPA) axis and was among the earliest peptide hormones to be characterized for its role in adrenal function.
Mechanism of Action: Melanocortin 2 Receptor Activation
ACTH 1-39 exerts its primary biological effects by binding to the melanocortin 2 receptor (MC2R) on adrenal cortical cells.
MC2R Activation: ACTH binding activates MC2R, a G-protein-coupled receptor expressed predominantly in the adrenal cortex.
cAMP Signaling: Receptor activation stimulates adenylyl cyclase, increasing intracellular cyclic AMP (cAMP) and activating protein kinase A (PKA).
Steroidogenesis: The resulting signaling cascade promotes cholesterol transport and steroidogenic activity within adrenal cortical cells, supporting the synthesis of glucocorticoids and other adrenal steroids.
HPA Axis Regulation: ACTH 1-39 functions as a key downstream effector of hypothalamic corticotropin-releasing hormone (CRH), making it an important research tool for investigating endocrine feedback and stress physiology.
Pharmacokinetic Profile
ACTH 1-39 is a relatively short-lived peptide that undergoes enzymatic degradation and clearance from circulation. Its pharmacokinetic properties make it useful for investigating transient activation of melanocortin receptors and downstream adrenal signaling pathways.
Key Research Applications
Adrenal Function and Steroidogenesis Research
ACTH 1-39 is extensively used in studies investigating adrenal cortical function and steroid hormone production:
- Adrenal Cortical Function: Investigate ACTH-dependent adrenal activity
- Cortisol Research: Study regulation of glucocorticoid synthesis
- Steroidogenesis: Explore signaling pathways involved in adrenal steroid production
- Adrenal Responsiveness: Investigate cellular responses to ACTH stimulation
HPA Axis Research
ACTH 1-39 provides an important tool for studying the central endocrine stress-response pathway:
- CRH-ACTH Signaling: Investigate communication between hypothalamic and pituitary systems
- Stress Physiology: Study endocrine responses to physiological and environmental stressors
- Negative Feedback: Explore glucocorticoid-mediated regulation of ACTH secretion
- Circadian Regulation: Investigate daily patterns of HPA-axis activity
Melanocortin Receptor Research
ACTH 1-39 is also relevant to studies of melanocortin receptor biology:
- MC2R Pharmacology: Characterize receptor activation and signaling
- Receptor Specificity: Investigate ACTH interactions with melanocortin receptor systems
- Signal Transduction: Study cAMP/PKA-mediated cellular responses
- Receptor Expression: Examine MC2R expression in adrenal and experimental cell models
Endocrine and Metabolic Research
ACTH signaling intersects with broader endocrine pathways:
- Glucocorticoid Regulation: Study adrenal hormone production
- Metabolic Signaling: Investigate relationships between adrenal hormones and metabolism
- Endocrine Disorders: Explore mechanisms associated with altered HPA-axis function
- Adrenal Physiology: Characterize hormonal regulation of adrenal tissue
Quality Assurance: Setting the Standard for Research Compounds
Manufacturing Excellence
peptology.store sources ACTH 1-39 from certified GMP facilities with rigorous quality-control protocols:
- HPLC Purity Analysis: ≥95% purity verified by high-performance liquid chromatography
- Mass Spectrometry Verification: Molecular weight confirmation via LC-HRMS
- Batch-Specific Certificates of Analysis: Complete documentation for each production run
- Research-Use Only (RUO) Labeling: Full compliance with research compound regulations
Chemical and Product Specifications
| Specification | Detail |
|---|---|
| Product Name | ACTH 1-39 (Adrenocorticotropic Hormone, Corticotropin) |
| CAS Number | 9002-60-2 |
| Molecular Formula | C₂₀₇H₃₀₈N₅₆O₅₈S |
| Molecular Weight | ~4,541.1 Da |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Structure | Linear 39-amino-acid peptide |
| Purity | ≥99% (HPLC verified) |
| Quantity | 5mg per vial |
| Appearance | White to off-white lyophilized powder |
| Form | Lyophilized powder |
| Solubility | Soluble in sterile water, bacteriostatic water, or PBS |
| Target Receptor | Melanocortin 2 receptor (MC2R) |
| Storage (Lyophilized) | -20°C; protect from light and moisture |
| Storage (Reconstituted) | 2-8°C for short-term; aliquot and store at -20°C for longer storage |
| Shelf Life | 24 months from date of manufacture (lyophilized) |
| Intended Use | Research and laboratory use only |
| Documentation | Certificate of Analysis provided with each batch |
Stability and Handling Guidelines
Lyophilized Powder Storage: Store lyophilized ACTH 1-39 powder at -20°C in a dry, dark environment, protected from light and moisture. Under proper storage conditions, the powder maintains stability for up to 24 months from the date of manufacture.
Reconstitution Protocol:
- Allow vial and solvent to reach ambient temperature before opening to prevent condensation.
- Reconstitute according to the applicable research protocol using a compatible sterile aqueous buffer.
- Introduce solvent carefully along the inside wall of the vial to minimize foaming.
- Gently swirl or roll the vial until dissolved—do not shake vigorously.
- Label the vial with the date of reconstitution.
- Refrigerate immediately at 2-8°C.
Reconstituted Solution Storage: Store reconstituted ACTH 1-39 at 2-8°C for short-term research use. For longer-term storage, aliquot into appropriate portions and store at -20°C. Avoid repeated freeze-thaw cycles.
Protection from Light and Moisture:
- Store in original packaging protected from light
- Keep vials tightly sealed when not in use
- Allow refrigerated vials to reach room temperature before opening to prevent condensation
Key Benefits
- Premium Quality Manufacturing: GMP-certified production, ≥99% HPLC-verified purity with lot-specific COAs
- Well-Characterized Peptide Hormone: ACTH 1-39 is the full-length 39-amino-acid form of adrenocorticotropic hormone
- MC2R Activity: Valuable research tool for investigating melanocortin 2 receptor signaling
- Adrenal Research: Study ACTH-mediated regulation of adrenal steroidogenesis
- HPA Axis Research: Investigate hypothalamic-pituitary-adrenal axis function and regulation
- Corticosteroid Research: Explore mechanisms involved in glucocorticoid and adrenal hormone production
- Melanocortin Receptor Pharmacology: Study receptor activation and downstream signaling pathways
- Stress-Response Research: Investigate endocrine mechanisms associated with physiological stress responses
- Endocrinology Studies: Examine pituitary-adrenal signaling and hormone regulation
- Well-Characterized Structure: Full-length 39-amino-acid peptide sequence
- Comprehensive Documentation: Certificates of Analysis with batch-specific purity data
- 48-Hour EU & UK Delivery: Rapid shipping to research facilities across Europe
- Batch Consistency: Rigorous quality control supports lot-to-lot reproducibility
- EU Sourced: Available from within the European Union
Frequently Asked Questions
Q: What is ACTH 1-39 and how does it work?
A: ACTH 1-39 (Adrenocorticotropic Hormone) is a 39-amino-acid peptide hormone produced by the pituitary gland. It acts primarily through the melanocortin 2 receptor (MC2R) in the adrenal cortex, activating signaling pathways involved in adrenal steroidogenesis.
Q: What purity level can I expect when I buy ACTH 1-39 from peptology.store?
A: All ACTH 1-39 from peptology.store is tested to ≥99% purity by HPLC, with Certificates of Analysis provided with every order. Each batch is individually analyzed for research applications.
Q: What is the molecular weight and sequence of ACTH 1-39?
A: ACTH 1-39 has an approximate molecular weight of 4,541 Da. Its 39-amino-acid sequence is SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
Q: How should I store ACTH 1-39 for long-term stability?
A: Store lyophilized ACTH 1-39 powder at -20°C, protected from light and moisture. Under appropriate storage conditions, the lyophilized material can maintain stability for extended periods. Reconstituted material should be handled according to the applicable research protocol.
Q: What is the solubility of ACTH 1-39?
A: ACTH 1-39 is generally compatible with aqueous research buffers. The appropriate solvent and concentration should be selected according to the specific laboratory research protocol.
Q: What research areas commonly use ACTH 1-39?
A: ACTH 1-39 is used in research involving adrenal endocrinology, HPA-axis signaling, melanocortin receptor pharmacology, steroidogenesis, stress-response mechanisms, and pituitary-adrenal regulation.
Q: What is the mechanism of action of ACTH 1-39?
A: ACTH 1-39 primarily activates the melanocortin 2 receptor (MC2R) on adrenal cortical cells. MC2R activation stimulates intracellular signaling that regulates steroidogenic pathways and adrenal hormone production.
Q: Do you ship ACTH 1-39 to EU countries?
A: Yes. As a dedicated peptide supplier, we ship ACTH 1-39 to all European Union member states with our guaranteed 48 hour delivery peptide service. Our EU fulfilment centre ensures rapid delivery without customs delays. All shipments use protective packaging to maintain compound integrity during transit.
Q: What documentation do you provide with ACTH 1-39 orders?
A: Every order includes a Certificate of Analysis (COA) with batch-specific purity data . Additional documentation, including HPLC chromatograms and mass spectrometry data, is available upon request for researchers requiring comprehensive analytical verification.
Q: Do you offer bulk quantities of ACTH 1-39 for institutional research?
A: Yes. We accommodate bulk orders for research institutions. Contact our team now for volume pricing, custom requirements, and supply agreements for ongoing research programs.
Advance Your Research with ACTH 1-39
peptology.store is your trusted source for ACTH 1-39, the premium choice for researchers investigating adrenal endocrinology, HPA-axis regulation, melanocortin receptor signaling, and steroidogenesis. As the full-length 39-amino-acid form of adrenocorticotropic hormone, ACTH 1-39 represents a well-characterized research tool for exploring the complex biology of pituitary-adrenal signaling.
Whether you are exploring adrenal steroidogenesis, designing HPA-axis studies, investigating ACTH receptor signaling, or researching stress-response mechanisms, our rigorously tested compound provides the quality and consistency your work demands.
Order today and experience the peptology.store difference – premium quality, rapid 48-hour delivery across the EU and UK, and expert support for the European research community.
